Demler Enterprise LLCWe currently are a RAPIDLY growing Scarp metal and Glass Recycler located in the Heartland of the USA..Address:1234, Oshkosh, Wisconsin, USAProduct/Service:metals: copper, brass, stainless steel, alluminum, zinc, other.glass: all types in cullet form. clear, amber, green, etc. some label residue remains.,,metals: copper, brass, stainless steel, alluminum, zinc, other.glass: all types in cullet form. clear, amber, green, etc. some label residue remains.,Pure Cullet CompanyPure Cullet is a recycled glass processor. We produce a color separated furnace ready cullet. Our cullet is contaminate free cullet. Our product can be used for a variety of uses, but mainly to be made into new consumer glass packaging..Address:Seattle, Washington, USAProduct/Service:furnace ready color separated glass cullet.,,furnace ready color separated glass cullet.,Dow Management LLCDow Management LLC is a recycling company located in united states. We specialze in recycling glass and turn it into raw material to be reuse for the market..Address:2640 E Garvey Ave S #104 West Covina CA United StatesProduct/Service:glass, cullet, beads, aggregate, grit, clean, clear, chips,glass, cullet, beads, aggregate, grit, clean, clear, chipsGreen Gifts LLCWe recycle and sell glass cullet 3/4" to fine sand grade for sandblasing. We also recycle and sell PVB. We sell eco art, art made of recycled materials,  info@ greengiftsaz.com 520.870.2136.Address:6282 W. Desert Laurel Ln. Street St. B, Tucson, Arizona, USAProduct/Service:cullet, recycled glass, pvb, recycling, float glassscrap glass, info @ greeniftsaz.com,Glass Cullet,,cullet, recycled glass, pvb, recycling, float glassscrap glass, info @ greeniftsaz.com,Glass Cullet,Executive Traders WorldwideThis supplier has not provided a Company Introduction yet..Address:501 Broad AveProduct/Service:Glass Cullet, Glass, , Glass,Used Beverage Container,,Glass Cullet, Glass, , Glass,Used Beverage Container,EcoGlass ManagementThis supplier has not provided a Company Introduction yet..Address:0 LaneProduct/Service:Crushed Glass,Glass Crushers , Crushed Glass Bottle Cullet,,Crushed Glass,Glass Crushers , Crushed Glass Bottle Cullet,Paragon Recycling GroupThis supplier has not provided a Company Introduction yet..Address:3600 Sullivant AvenueProduct/Service:Copper Wire, Baled Plastic, Baled Aluminum, , CRT Glass Cullet,,Copper Wire, Baled Plastic, Baled Aluminum, , CRT Glass Cullet,Cincinnati Recycling SolutionsCommunity Recycling Program aimed at Cincinnati's small business sector. Selling raw goods to local companies..Address:6237 Gracely Dr.Product/Service:Ohio, Kentucky, Indiana, , Crushed Glass Cullet,,Ohio, Kentucky, Indiana, , Crushed Glass Cullet,XS MachineryThis supplier has not provided a Company Introduction yet..Address:161 Burlington RdProduct/Service:equipment,glass , Glass Cullet,,equipment,glass , Glass Cullet,Ringland Development CorpThis supplier has not provided a Company Introduction yet..Address:3300 Chiquita BlvdProduct/Service:Glass,Cullet,Paper , Waste Paper,,Glass,Cullet,Paper , Waste Paper,Strategic MaterialsThis supplier has not provided a Company Introduction yet..Address:2550 W Minnesots StProduct/Service:Glass cullet,terrazzo chips,landscape glass ,,Glass cullet,terrazzo chips,landscape glass ,GREEN PhilaGREEN Phila is a Philadelphia based supplier of variety scrap glass and metal products. We have our products delivered to your location on regular basis. For buyers, we designed "plug play" system, which requires very little effort behalf customers. ....Address:6349 Militia Ct, Bensalem, Pennsylvania, USAProduct/Service:glass cullet, lead, lead batteries, scrap metal, gold, silver, copper,,glass cullet, lead, lead batteries, scrap metal, gold, silver, copper,Absolute Auto Glass LLCWe recycle and sell glass cullet 3/4" to fine sand grade for sandblasing. We also recycle and sell PVB..Address:125 W. Ventura Street St. B, Tucson, Arizona, USAProduct/Service:cullet, recycled glass, pvb,Cullet, glass, pvb,,cullet, recycled glass, pvb,Cullet, glass, pvb,Reusable AssetsWe are one of the largest Electronics Recyclers on east coast. handle Computer components, Scrap materials, whole systems, printers, monitors, tvs, Air conditioners, Batteries, UPS Power supply, Metals, Plastics, and much more. filling containers a daily basis. Please call our sales dept. And inquire ....Address:1950 Rutgers University BlvdProduct/Service:Scrap Computer Components,Printers,Monitors,Waste Products,Waste Metals,Waste Plastics,Waste Glass , Ballast,Black Plastic Televisions,Test Equipment,Used Terminals,UPS Power Supply,Clean Copper,Gold fingers,Hard Drive Boards,Memory for recovery,POS Equipment,Printer/Fax/Copier,SUN Systems,Gold Processors,Glass Cullet,Baled Monitor boards,Copper Yokes,Network Equipment,Copper Transformers,Memory,Hard Drive Breakage,Fridge Motors,Processors for resale,CD/Floppy mix,Forklift lead acid battery,Used Virgin Toner Cartridges,High End Circuit Boards,Broken Plasma/LCD TV's,Baled Aluminum,Laptops,LCD Monitors,CRT Monitors,WTS: Air Conditioners,,Scrap Computer Components,Printers,Monitors,Waste Products,Waste Metals,Waste Plastics,Waste Glass , Ballast,Black Plastic Televisions,Test Equipment,Used Terminals,UPS Power Supply,Clean Copper,Gold fingers,Hard Drive Boards,Memory for recovery,POS Equipment,Printer/Fax/Copier,SUN Systems,Gold Processors,Glass Cullet,Baled Monitor boards,Copper Yokes,Network Equipment,Copper Transformers,Memory,Hard Drive Breakage,Fridge Motors,Processors for resale,CD/Floppy mix,Forklift lead acid battery,Used Virgin Toner Cartridges,High End Circuit Boards,Broken Plasma/LCD TV's,Baled Aluminum,Laptops,LCD Monitors,CRT Monitors,WTS: Air Conditioners,MSM Imperial Investment Group IncMSM Imperial Investment Group is an international company specialized in doing business the Global Marketplace. Established 2001, has offices and legal representatives worldwide. One of major office located Rivne Ukraine. Other representative are Azerbaijan, Germany, Russia, Kazakhstan, ....Address:620 N. Kenwood St. #107, Glendale, Ca, USAProduct/Service:food & beverages, metal, sugar, fertilizer, cullet glass, scrap and water,,food & beverages, metal, sugar, fertilizer, cullet glass, scrap and water,Datam ManufacturingDatam Manufacturing was established to handle international relations for all of the parent companies. Some companies are involved in following fields: Automotive OEM, Precision Machining, Scrap Yards, coatings, technology, engineering. Common ownership. ....Address:1150 Stephenson HwyProduct/Service:Automotive,Precision Machining,Scrap Metals , Copper Scrap,Cold Rolled Steel,Automotive Scrap,Radiator Scrap,Engine And Transmission Scrap,Recycled Glass Aggregate,Recycled Glass Aggregate,Recycled Winshield Glass Cullet,Recycled PVB from Windshields,Recycled Mixed Plastic,,Automotive,Precision Machining,Scrap Metals , Copper Scrap,Cold Rolled Steel,Automotive Scrap,Radiator Scrap,Engine And Transmission Scrap,Recycled Glass Aggregate,Recycled Glass Aggregate,Recycled Winshield Glass Cullet,Recycled PVB from Windshields,Recycled Mixed Plastic,Higher Ground Energy Solutions, Incwddkhfeikncwoihiwhiinifknidsancidnirenkvniriwidekfmfnfjfjfjfjfkdddmdmjejejenemelldkfjffnremememjfjfjfjmnfnrerjekjkfkfmrfnrenrejf.Address:602 sweetwater ave, florence, alabama, USAProduct/Service:plush toys, cullet, animal fats, feedstocks, bio-diesel,,plush toys, cullet, animal fats, feedstocks, bio-diesel,
1
